Art of Problem Solving
AoPS Online
Math texts, online classes, and more
for students in grades 5-12.
Visit AoPS Online ‚
Books for Grades 5-12 Online Courses
Beast Academy
Engaging math books and online learning
for students ages 6-13.
Visit Beast Academy ‚
Books for Ages 6-13 Beast Academy Online
AoPS Academy
Small live classes for advanced math
and language arts learners in grades 2-12.
Visit AoPS Academy ‚
Find a Physical Campus Visit the Virtual Campus

Orphaned pages

The following pages are not linked from or transcluded into other pages in AoPS Wiki.

Showing below up to 500 results in range #1 to #500.

View (previous 500 | next 500) (20 | 50 | 100 | 250 | 500)

  1. "* in a unit circle"
  2. ++ ดูหนังมาใหม่ ธี่หยด (2023) Tee Yod หนังชนโรง หนังออนไลน์ฟรี
  3. 14639201037200387267
  4. 19329 contest math: intro to geometry
  5. 1939 AMC 8 Problems
  6. 1959–1966 IMO Longlist Problems/Czechoslovakia 1
  7. 1967 AHSME Problems/Problem 49
  8. 1967 AHSME Problems/Problem 50
  9. 1970 AMC 12
  10. 1983 AIME/Answer Key
  11. 1983 USAMO Problem 1
  12. 1984 AJHSME Problem 9
  13. 1985 AJHSME Problems/Problem 0
  14. 1991 OIM Problems/Problem 7
  15. 20
  16. 2000˙AIME˙II˙Problems/Problem˙3
  17. 2001 AMC 12 Printable
  18. 2002 AMC 10P Problems/Problem 15
  19. 2002 SMT
  20. 2003 SMT
  21. 2004 AMC 10A Answers
  22. 2004 SMT
  23. 2005 AIME
  24. 2005 CEMC Gauss (Grade 7) Problems/Problem 2a
  25. 2005 SMT
  26. 2006 AIME
  27. 2006 GCTM State Tournament Problems/Individual Problem 46
  28. 2007 AIME
  29. 2007 AIME Root(2)
  30. 2007 SMT
  31. 2007 USA TST Problems
  32. 2008 AIME
  33. 2008 AMC 12 A
  34. 2008 Polish Mathematical Olympiad Third Round
  35. 2008 SMT
  36. 2008 UNC Math Contest II Problems/Problem 1
  37. 2009 MMATHS Individual Round Problems/Problem 1
  38. 2009 PUMaC Problems
  39. 2009 Polish Mathematical Olympiad Third Round
  40. 2009 SMT
  41. 2009 Zhautykov International Olympiad Problems
  42. 2010-2011 Mock USAJMO 2 Problems/Solutions
  43. 2010 AMC 12A Problems Raw
  44. 2010 SMT
  45. 2012 EGMO
  46. 2013 EGMO Problems
  47. 2013 TSTST Problems
  48. 2014 EGMO Problems
  49. 2014 UNC) Math Contest II Problems
  50. 2014 UNM-PNM Math Contest II Problems/Problem 2
  51. 2015 EGMO Problems
  52. 2015 Final tour - Azerbaijan in lower age category
  53. 2016 AMC 10 Problems
  54. 2016 EGMO Problems
  55. 2016 Mathcounts State Sprint Problems
  56. 2017 AMC 10B Problems/Problem 12/section=4
  57. 2017 EGMO Problems
  58. 2018 AMC 12 Problems/Problem 16
  59. 2018 EGMO Problems
  60. 2018 TSTST Problems
  61. 2019 AIME Problems
  62. 2019 AIME Problems/Problem 2
  63. 2019 AMC 10
  64. 2019 EGMO Problems
  65. 2019 ELMO Problems
  66. 2019 USAJMO Problems/Problem 10
  67. 2019 USAJMO Problems/Problem 69
  68. 2020 AMC 8 Problems/em 1
  69. 2020 EGMO Problems
  70. 2020 FMC 10A Problems
  71. 2020 FMC 12A Problems
  72. 2020 MATHCOUNTS Problems/Problem 8
  73. 2020 Mock Combo AMC 10
  74. 2020 USAMTS Round 1 Problems/Problem 3
  75. 2020 USAMTS Round 1 Problems/Problem 4
  76. 2020 USAMTS Round 1 Problems/Problem 5
  77. 2021 AMC 10B Problems/Problem 26
  78. 2021 AMC 10C
  79. 2021 AMC 10D
  80. 2021 AMC 1 Problems
  81. 2021 AMC 8 Problems
  82. 2021 AMC 8 Problems/Problem 1
  83. 2021 AMC 8 Problems/Problem 18
  84. 2021 AMC 8 Problems/Problem 2
  85. 2021 April MIMC 10
  86. 2021 April MIMC Problems/Problem 18
  87. 2021 April MIMC Problems/Problem 19
  88. 2021 EGMO Problems
  89. 2021 Euclid Problems
  90. 2021 Fall MIMC 10
  91. 2021 GMC 10B
  92. 2021 GMC 12
  93. 2021 GMC 12B
  94. 2021 HMC 10
  95. 2021 JMC 10
  96. 2021 JMPSC
  97. 2021 JMPSC Answer Key
  98. 2021 JMPSC Problems/Problem 1
  99. 2021 JMPSC Problems/Problem 2
  100. 2021 MECC Mock AMC 10
  101. 2021 MECC Mock AMC 12
  102. 2021 Mock AMC 8 Problems
  103. 2021 Mock AMC 8 Problems/Problem 1
  104. 2021 Mock AMC 8 Problems/Problem 2
  105. 2021 Mock AMC 8 Problems/Problem 3
  106. 2021 WSMO
  107. 2021 WSMO Speed Round/Problem 1
  108. 2021 ZeMC10
  109. 2022 DMC 10A Problems
  110. 2022 EGMO Problems
  111. 2022 Fall AMC 10B Problems
  112. 2022 MMATHS
  113. 2022 MMATHS Individual Round
  114. 2022 MMATHS Individual Round Problems
  115. 2022 MMATHS Problems/Problem 1
  116. 2023 AMC 10A Problems/Problem 26
  117. 2023 AMC 10A Problems/Problem 27
  118. 2023 AMC 10B Problems/Problem 26
  119. 2024 AMC 10B
  120. 2024 AMC 8 Problems/Problem 26
  121. 2024 AMC 8 Problems/Problem 27
  122. 2024 UAJMO Problems
  123. 2025 AMC 10A
  124. 2026 AMC 8 Problems
  125. 2027 AMC 8 Problems/Problem 1
  126. 2028 AMC 8
  127. 2030 AIME I
  128. 2050 AIME I
  129. 2100 AMC 8 Problems
  130. 403
  131. 404
  132. 7
  133. A
  134. A-Star Winter Math Camp
  135. A.chepuri
  136. AAMC
  137. AMC 10P
  138. AMC 12C 2019
  139. AMC 12C 2019/Problem 1
  140. AMC 12C 2020
  141. AMC 4
  142. AMC 8 Scheiße Scheisse and Solutions
  143. AMC 8 practice test
  144. AOPS
  145. API::Order::generate
  146. API:Product:get weight
  147. API Main Page
  148. AP Calculus
  149. A choose b
  150. A game board is constructed by shading two of the regions formed by the altitudes of an equilateral triangle as shown. What is the probability that the tip of the spinner will come to rest in a shaded region? Express your answer as a common fraction.
  151. A stock loses $10\%$ of its value on Monday. On Tuesday it loses $20\%$ of the value it had at the end of the day on Monday. What is the overall percent loss in value from the beginning of Monday to the end of Tuesday? Enter the answer as a percent.
  152. About weihang
  153. Aceplays
  154. Action
  155. Adazhao1227
  156. Add
  157. Additional signaling system at work
  158. Adriancheung
  159. Advanced Gmaasology
  160. Advanced Placement
  161. Ajax
  162. Alcumus
  163. Alex
  164. Algebra 2023
  165. Ali-A
  166. Alicebarnes33
  167. Alkjl
  168. All about Magic
  169. Alt front page
  170. Alternating permutation
  171. American Math Challenge
  172. Angle Addition Formulas (Trigonometry)
  173. Annual Inequations Contest
  174. Anthony Yang
  175. AoPSML Main Page
  176. AoPSWiki:Article of the Day/Archive
  177. AoPSWiki:Community Portal
  178. AoPS Math Club
  179. AoPS Online School/Algebra 2
  180. AoPS Online Schoolhouse
  181. Aops Guide to Math!
  182. Aops language
  183. Aopsav
  184. Aopslandia
  185. Apple
  186. Applicant Tracking Systems
  187. Arclength
  188. Areteem Camp
  189. Areteem Institute Summer Math Programs
  190. Arienhost.com
  191. Arrangement Restriction Theorem
  192. Arthur Benjamin
  193. Arthur Holly Compton Fellowships in the Physical Sciences and Mathematics
  194. Asymptote: Crash Course
  195. Asymptote: Example 1
  196. Asymptote: Macintosh
  197. Autograph
  198. Avid Academy for Gifted Youth
  199. Avogadro's Constant
  200. Awesomeguy856
  201. Awesomeming327
  202. Ayy-opsss
  203. B
  204. B2025tyx
  205. Badges
  206. Bard Math Circle Creative and Analytical Math Program (C.A.M.P.)
  207. Barrington High School
  208. Base arithmetic
  209. Base introduction
  210. Bash
  211. Bay Area Math Olympiad
  212. Beckyspencer3
  213. Benhlyrangcom
  214. Besot Power Series
  215. BestieTheorem
  216. Bestzack66's AMC10 Study Plan
  217. Bibhorr Formula
  218. Bill's Triangle
  219. Binomial Nomenclature
  220. Biswadev
  221. Bjc
  222. Blank Page
  223. BlockFi
  224. Bob Smart
  225. BoddapatiS
  226. Boredom Buster
  227. Brachistochrone
  228. Brazilformula
  229. Brocard's problem
  230. Brute for
  231. Bézout's Lemma
  232. CMO
  233. CSS: Downloads
  234. CSS: Positioning
  235. CSS: Properties
  236. CSS and HTML fundamentals
  237. Calculators
  238. Caltech
  239. Caltech Math Meet
  240. Camp-euclid
  241. Casey's Theoram
  242. Catch 22
  243. Catenary
  244. Cauchy's Criterion
  245. Cauchy-davenport
  246. Cavalieri's principle
  247. Cayley's Theorem
  248. Cell Theory
  249. Central NC MathCounts
  250. Centslordm
  251. Chakravala method
  252. Challenge Math Online Program
  253. Changelog
  254. Channing421
  255. Charfoal
  256. Chen's Theorem
  257. Chittur Gopalakrishnavishwanathasrinivasaiyer Lemma
  258. Circle Theorems
  259. Class Badges
  260. Classroom hacks
  261. Cloud neek
  262. Coalition Under Lovers of Trees
  263. Cohn's criterion
  264. Collections
  265. Complete residue system
  266. Computer simulation
  267. Concave Function
  268. Conservation of Momentum
  269. Constraints Strategy
  270. Contest Statistics
  271. Cool972 AMC 8 I
  272. Cozzmo
  273. Creating edited defaults
  274. Critical point
  275. Crouton
  276. Crusade
  277. Cumsniffer
  278. Curisen
  279. Curvature
  280. Cyclic function
  281. DVI exam
  282. Decagon
  283. Decembersnow13
  284. Decibel
  285. Descent
  286. Did you know that 3-2=1?
  287. Digon
  288. Dihedral angle
  289. Direacted lenght
  290. Direct Image Link
  291. Discordbetterthanaops
  292. Discrete quantity
  293. Dissection
  294. Distinct lines
  295. Doctorwho11
  296. Doggo
  297. Dolphinday
  298. Donguri
  299. Douglasubella
  300. Dunan's Theorem
  301. Dunan League
  302. Duwipr
  303. Earth
  304. Earth Science
  305. Easter Eggs
  306. Editing 2010 AMC 8 PROBLEMS/PROBLEM 24
  307. Ehawk11
  308. Emojis
  309. Erich Owen
  310. ErickMeyer4
  311. Euclid Problems and Solutions
  312. Euclid history Problems
  313. Euler's Four-Square Identity
  314. Euler's formula and It's history
  315. Euler's theorem
  316. European Girls' Mathematical Olympiad
  317. Exponentiation by squaring
  318. Exradius
  319. F=ma Exam
  320. FBIA
  321. FMO Problems and Solutions
  322. Fat Man on a Seesaw
  323. Fermat's Two Squares Theorem
  324. Fermat numbers
  325. Feuerbach point
  326. Finite Fourier Analysis
  327. Firecobra100
  328. First hundred primes
  329. Fixer
  330. Flec
  331. Fluorescence
  332. Foot Prints Of God
  333. Footballjornalista/
  334. For what real values of $c$ is $4x^2 + 5x^2 + 14x + x + c$ the square of a binomial?
  335. Forms of Figurative Language
  336. Formulas relating the number of lines, sections, and intersection points
  337. Forum Etiquette
  338. Forums
  339. Four
  340. Four fair coins are to be flipped. What is the probability that all four will be heads or all four will be tails? Express your answer as a common fraction.
  341. François Viète
  342. Invalid title with namespace "(Main)" and text "François_Viète"
  343. Free magma
  344. Frobenius automorphism
  345. Fucongcong
  346. Full of Baloney
  347. Fun Math Puzzles Unofficial
  348. GIFs
  349. GMAAS
  350. Gaamster
  351. Game Programming Contest
  352. Garmin launches a new FDA-cleared ECG app for the Venu 2 Plus
  353. Gauss's Lemma
  354. Gauss (Gr. 7 & 8)
  355. Gauss Grade 7 Year 2011 Problem 1
  356. Gauss Grade 7 Year 2011 Problem 2
  357. Gauss Grade 7 Year 2011 Problem 4
  358. Geometry Solutions
  359. Georgeooga-Harryooga Theroem
  360. Gergonne's Theorem
  361. Getting Started With JavaScript Programming
  362. Gg boiiis
  363. Ghsfaodsjfsdf theorum
  364. GloriaVaughn2
  365. Gmaasalaxy
  366. Gmaasiverse
  367. Gods Fighting Sim
  368. Graphgrid.asy
  369. Grog
  370. Halp!
  371. Happyshark's User Page
  372. Harry Kim
  373. Harvey
  374. Heavytoothpaste
  375. Helios Hong
  376. Hendecagon
  377. Heptadecagon
  378. Hexadecagon
  379. High-Quality Games and Fun
  380. Honest day's work
  381. Hook Length Theorem
  382. Horsepower
  383. Hotmonkey's current phrase
  384. How many four-digit, positive integers are there where each digit is a prime number?
  385. How many prime numbers are between 30 and 40?
  386. How many times does the digit 9 appear in the list of all integers from 1 to 500? (The number $ 99 $, for example, is counted twice, because $9$ appears two times in it.)
  387. How many ways can $1995$ be factored as a product of two two-digit numbers? (Two factorizations of the form $a\cdot b$ and $b\cdot a$ are considered the same).
  388. How should I prepare?
  389. How to Add and Subtract One-Digit Numbers
  390. How to Learn Turkish Language Fast
  391. How to display images or GIFs
  392. How to set up your new computer the right way
  393. HowtoHangStringLights
  394. Https://artofproblemsolving.com/wiki/index.php?title=File:AMC logo.png
  395. Huili2010
  396. Hyperbolic trig functions
  397. Hyundai Ioniq 5
  398. IDEAMATH
  399. Iabzcq
  400. Ice neek
  401. Icosagon
  402. Icosidigon
  403. Icosihenagon
  404. Idempotence
  405. Idkhtan Theorem
  406. If I have four boxes arranged in a $2 \times 2$ grid, in how many distinct ways can I place the digits $1$, $2$, and $3$ in the boxes, using each digit exactly once, such that each box contains at most one digit? (I only have one of each digit, so one box
  407. If no one shares an office, in how many ways can 3 people be assigned to 5 different offices? (Each person gets exactly one office).
  408. In the diagram, the equilateral triangle has a base of $8$ m. What is the perimeter of the triangle?
  409. In triangle ABC, D be a point in BC, ∠BAD = 30 , ∠CAD = 90 , BD=1=AC, DC =
  410. Index.php
  411. Indianvv
  412. Infinite Defenestration
  413. Inscribed Angle Proof(1)
  414. Insiders bet more on Fizz a social network that has now bubbled up at 80 college campuses
  415. Integrals
  416. IntelligentElephant2010
  417. Intermediate value property
  418. Internal combustion engines
  419. International Math Bowl
  420. Inverse trigonometric function
  421. Involution
  422. It1023
  423. JDKim
  424. JMPSC 2022 Division 1 Round 2 Problem 14
  425. JMPSC 2022 Problems
  426. Jadhav Quadratic Formula
  427. Jamesgray
  428. Jason321
  429. Jason Batterson
  430. Javascript
  431. Jayasharmaramankumarguptareddybavarajugopal's Lemma
  432. Jeff Boyd
  433. Joe wants to find all the four-letter words that begin and end with the same letter. How many combinations of letters satisfy this property?
  434. Jomity
  435. Joshua zucker
  436. Jugemu Jugemu Goko no Surikire Kaijarisuigyo no Suigyomatsu Unraimatsu Furaimatsu Ku Neru Tokoro ni Sumu Tokoro Yabura Koji no Bura Koji Paipo-paipo Paipo no ShuringanShuringan no Gurindai Gurindai no Ponpokopi no Ponpokona no Chokyumei no Chosuke.
  437. Juliankuang
  438. Jupiter314
  439. K1glaucus
  440. KGS math club
  441. Kenzopoker
  442. Kevin Zhao
  443. Kirchhoff's rules
  444. KiwiYum
  445. Kiwibird52
  446. Know the Facts: Gmaas
  447. Kuytltuyluyc
  448. Invalid title with namespace "(Main)" and text "L'Hôpital's_Rule"
  449. LaTeX/Installing
  450. Laa: Packages
  451. Lagrange Multipliers
  452. Latin square
  453. Laurent Series
  454. Lcz's Mock AMC 10A
  455. Lcz's Mock AMC 10A Problems
  456. Lcz's Oly Notes
  457. Lcz Notes!
  458. Learning Physics!
  459. Let $x$ be the number $9$ followed by $2015$ zeros. What is smallest integer greater than or equal to $x$ that is divisible by 11? Expression your answer in terms of $x$.
  460. Let a and b be nonzero real numbers such that (2 - 7i)(a + bi)is pure imaginary. Find a/b.
  461. Lifting the Exponent Lemma
  462. Lillian
  463. Liouville's Theorem
  464. List of national MathCounts teams
  465. Look at their Health Needs
  466. Lorde Shares Sweet Texts From Taylor Swift
  467. Lorentz Factor
  468. LostInBali
  469. LouisMedina23
  470. Lucasfunnyface
  471. Luckypotatopoo
  472. Luke zhang
  473. LuzPowell2
  474. MIE 2016/Day 1/Problem 10
  475. MIE 2016/Day 1/Problem 6
  476. MIE 2016/Day 1/Problem 7
  477. MIE 2016/Day 1/Problem 8
  478. MIE 2016/Problem 2
  479. MIE 2016/Problem 9
  480. MMFC
  481. MNCTOTO
  482. MSHSML Problems and Solutions
  483. MaCh 8
  484. Maggie
  485. Magic Problem
  486. Magic squares
  487. Main Page/Suggestions
  488. Main page
  489. Making AI with Python
  490. Manchestermag.com
  491. Marin Mersenne
  492. Mark888's Hangout Corner
  493. Massass
  494. Math2016Center
  495. MathCON
  496. MathCounts: National Cutoffs
  497. MathLegend27
  498. Math Contest Camp 2008
  499. Math Contest Camp 2009
  500. Math Contest Camp 2010

View (previous 500 | next 500) (20 | 50 | 100 | 250 | 500)

Retrieved from "https://artofproblemsolving.com/wiki/index.php/Special:LonelyPages"